PMID- 12668203
OWN - NLM
STAT- MEDLINE
DCOM- 20040112
LR  - 20190818
IS  - 0196-9781 (Print)
IS  - 0196-9781 (Linking)
VI  - 24
IP  - 2
DP  - 2003 Feb
TI  - Bombinakinin M gene associated peptide, a novel bioactive peptide from skin 
      secretions of the toad Bombina maxima.
PG  - 199-204
AB  - A novel 28-amino acid peptide, termed bombinakinin-GAP, was purified and 
      characterized from skin secretions of the toad Bombina maxima. Its primary 
      structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH(2), in which two 
      cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 
      32% sequence identity between the sequences of the peptide and a segment of rat 
      cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular 
      (i.c.v.) administration of the peptide induced a significant decrease in food 
      intake in rats, suggesting that it played a role in the control of feeding by 
      brain. Analysis of its cDNA structure revealed that this peptide is coexpressed 
      with bombinakinin M, a bradykinin-related peptide from the same toad. 
      Bombinakinin-GAP appears to be the first example of a novel class of bioactive 
      peptides from amphibian skin, which may be implicated in feeding behavior.
FAU - Lai, Ren
AU  - Lai R
AD  - Department of Animal Toxinology, Kunming Institute of Zoology, The Chinese 
      Academy of Sciences, 32 East Jiao Chang Road, Yunnan 650223, Kunming, PR China.
FAU - Liu, Hen
AU  - Liu H
FAU - Lee, Wen Hui
AU  - Lee WH
FAU - Zhang, Yun
AU  - Zhang Y
LA  - eng
SI  - GENBANK/AF515613
PT  - Comparative Study
PT  - Journal Article
PT  - Research Support, Non-U.S. Gov't
PL  - United States
TA  - Peptides
JT  - Peptides
JID - 8008690
RN  - 0 (DNA, Complementary)
RN  - 0 (Kinins)
RN  - 0 (Nerve Tissue Proteins)
RN  - 0 (bombinakinin M gene associated peptide, Bombina maxima)
RN  - 0 (cocaine- and amphetamine-regulated transcript protein)
SB  - IM
MH  - Amino Acid Sequence
MH  - Animals
MH  - Anura/*genetics/metabolism
MH  - Base Sequence
MH  - Chromatography, High Pressure Liquid
MH  - Cloning, Molecular
MH  - DNA, Complementary/chemistry/genetics
MH  - Dose-Response Relationship, Drug
MH  - Eating/drug effects
MH  - Injections, Intraventricular
MH  - Kinins/chemistry/*genetics/pharmacology
MH  - Male
MH  - Molecular Sequence Data
MH  - Nerve Tissue Proteins/genetics
MH  - Rats
MH  - Rats, Wistar
MH  - Sequence Analysis, DNA
MH  - Sequence Homology, Amino Acid
MH  - Skin/*metabolism
MH  - Time Factors
EDAT- 2003/04/02 05:00
MHDA- 2004/01/13 05:00
CRDT- 2003/04/02 05:00
PHST- 2003/04/02 05:00 [pubmed]
PHST- 2004/01/13 05:00 [medline]
PHST- 2003/04/02 05:00 [entrez]
AID - S0196978103000275 [pii]
AID - 10.1016/s0196-9781(03)00027-5 [doi]
PST - ppublish
SO  - Peptides. 2003 Feb;24(2):199-204. doi: 10.1016/s0196-9781(03)00027-5.