PMID- 15626370
OWN - NLM
STAT- MEDLINE
DCOM- 20050330
LR  - 20061115
IS  - 0041-0101 (Print)
IS  - 0041-0101 (Linking)
VI  - 45
IP  - 2
DP  - 2005 Feb
TI  - Primary structure, behavioral and electroencephalographic effects of an 
      epileptogenic peptide from the sea anemone Bunodosoma cangicum.
PG  - 207-17
AB  - The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone 
      Bunodosoma cangicum, was determined: 
      GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 
      residues that are conserved and the 5 that are conservatively substituted within 
      or between the type 1 and type 2 sequences of sea anemone peptides with specific 
      action on voltage-sensitive sodium channels. Furthermore, it also has 6 
      identities (Asp9, Arg14, Asn16, Leu18, Trp33 and Lys48) and 1 homology (Arg36) in 
      the 8 residues of the pharmacophore of the sea anemone ApB which are essential 
      for interaction with mammalian sodium channels. The intrahippocampal injection of 
      CGX induces several sequential behavioral alterations--episodes of akinesia 
      alternating with facial automatisms and head tremor, salivation, rearing, 
      jumping, barrel-rolling, wet dog shakes and forelimb clonic movements--and the 
      electroencephalography analysis shows that they were followed by important 
      seizure periods that gradually evolved to status epilepticus that lasted 8-12 h, 
      similar to that observed in the acute phase of the pilocarpine model of epilepsy. 
      These results suggest that CGX may be an important tool to develop a new 
      experimental model of status epilepticus which may contribute to understanding 
      the etiology of epilepsy and to test the effects of new antiepileptic drugs.
FAU - Cunha, Ricardo B
AU  - Cunha RB
AD  - Centro Brasileiro de Servicos e Pesquisas em Proteinas, Departamento de Biologia 
      Celular, Universidade de Brasilia, CEP 70.910-900 Brasilia, DF, Brazil.
FAU - Santana, Alfredo N C
AU  - Santana AN
FAU - Amaral, Patricia C
AU  - Amaral PC
FAU - Carvalho, Maria D F
AU  - Carvalho MD
FAU - Carvalho, Doris M F
AU  - Carvalho DM
FAU - Cavalheiro, Esper A
AU  - Cavalheiro EA
FAU - Maigret, Bernard
AU  - Maigret B
FAU - Ricart, Carlos A O
AU  - Ricart CA
FAU - Cardi, Bruno A
AU  - Cardi BA
FAU - Sousa, Marcelo V
AU  - Sousa MV
FAU - Carvalho, Krishnamurti M
AU  - Carvalho KM
LA  - eng
PT  - Journal Article
PT  - Research Support, Non-U.S. Gov't
PL  - England
TA  - Toxicon
JT  - Toxicon : official journal of the International Society on Toxinology
JID - 1307333
RN  - 0 (Cnidarian Venoms)
SB  - IM
MH  - Amino Acid Sequence
MH  - Animals
MH  - Behavior, Animal/*drug effects
MH  - Cnidarian Venoms/*chemistry/*toxicity
MH  - Electroencephalography/*drug effects
MH  - Male
MH  - Molecular Sequence Data
MH  - Rats
MH  - Rats, Wistar
MH  - Sea Anemones
MH  - Seizures/*chemically induced
MH  - Sequence Homology, Amino Acid
EDAT- 2005/01/01 09:00
MHDA- 2005/03/31 09:00
CRDT- 2005/01/01 09:00
PHST- 2004/03/23 00:00 [received]
PHST- 2004/10/11 00:00 [revised]
PHST- 2004/10/13 00:00 [accepted]
PHST- 2005/01/01 09:00 [pubmed]
PHST- 2005/03/31 09:00 [medline]
PHST- 2005/01/01 09:00 [entrez]
AID - S0041-0101(04)00440-4 [pii]
AID - 10.1016/j.toxicon.2004.10.011 [doi]
PST - ppublish
SO  - Toxicon. 2005 Feb;45(2):207-17. doi: 10.1016/j.toxicon.2004.10.011.