PMID- 23594231
OWN - NLM
STAT- MEDLINE
DCOM- 20130709
LR  - 20221207
IS  - 1520-4804 (Electronic)
IS  - 0022-2623 (Linking)
VI  - 56
IP  - 9
DP  - 2013 May 9
TI  - Structure and function of a potent lipopolysaccharide-binding antimicrobial and 
      anti-inflammatory peptide.
PG  - 3546-56
LID - 10.1021/jm4004158 [doi]
AB  - Antimicrobial peptides (AMPs) play pivotal roles in the innate defense of 
      vertebrates. A novel AMP (cathelicidin-PY) has been identified from the skin 
      secretions of the frog Paa yunnanensis . Cathelicidin-PY has an amino acid 
      sequence of RKCNFLCKLKEKLRTVITSHIDKVLRPQG. Nuclear magnetic resonance (NMR) 
      spectroscopy analysis revealed that cathelicidin-PY adopts a tertiary structure 
      with a mostly positively charged surface containing a helix (Thr15-Ser19). It 
      possesses strong antimicrobial activity, low hemolytic activity, low cytotoxicity 
      against RAW 264.7 cells, and strong anti-inflammatory activity. The action of 
      antimicrobial activity of cathelicidin-PY is through the destruction of the cell 
      membrane. Moreover, cathelicidin-PY exerts anti-inflammatory activity by 
      inhibiting the production of nitric oxide (NO) and inflammatory cytokines such as 
      tumor necrosis factor (TNF-alpha), interleukin-6 (IL-6), and monocyte chemoattractant 
      protein-1 (MCP-1). Cathelicidin-PY inhibits the activation of Toll-like receptor 
      4 (TLR4) inflammatory response pathways induced by lipopolysaccharide (LPS). The 
      NMR titration experiments indicated that cathelicidin-PY can bind to LPS. In 
      conclusion, we have identified a novel potent peptide antibiotic with both 
      antimicrobial and anti-inflammatory activities and laid the groundwork for future 
      research and development.
FAU - Wei, Lin
AU  - Wei L
AD  - Life Sciences College of Nanjing Agricultural University , Nanjing 210095, 
      Jiangsu, China.
FAU - Yang, Juanjuan
AU  - Yang J
FAU - He, Xiaoqin
AU  - He X
FAU - Mo, Guoxiang
AU  - Mo G
FAU - Hong, Jing
AU  - Hong J
FAU - Yan, Xiuwen
AU  - Yan X
FAU - Lin, Donghai
AU  - Lin D
FAU - Lai, Ren
AU  - Lai R
LA  - eng
SI  - GDB/2LR7
PT  - Journal Article
PT  - Research Support, Non-U.S. Gov't
DEP - 20130429
PL  - United States
TA  - J Med Chem
JT  - Journal of medicinal chemistry
JID - 9716531
RN  - 0 (Anti-Infective Agents)
RN  - 0 (Anti-Inflammatory Agents)
RN  - 0 (Antimicrobial Cationic Peptides)
RN  - 0 (Cytokines)
RN  - 0 (Lipopolysaccharides)
RN  - 0 (Solutions)
RN  - 31C4KY9ESH (Nitric Oxide)
RN  - 0 (Cathelicidins)
SB  - IM
MH  - Amino Acid Sequence
MH  - Animals
MH  - Anti-Infective Agents/*chemistry/metabolism/*pharmacology/toxicity
MH  - Anti-Inflammatory Agents/*chemistry/metabolism/*pharmacology/toxicity
MH  - Antimicrobial Cationic Peptides/*chemistry/metabolism/*pharmacology/toxicity
MH  - Anura
MH  - Bacteria/drug effects
MH  - Base Sequence
MH  - Cell Line
MH  - Cytokines/biosynthesis
MH  - Female
MH  - Fungi/drug effects
MH  - Hemolysis/drug effects
MH  - Humans
MH  - Lipopolysaccharides/*metabolism/pharmacology
MH  - Male
MH  - Mice
MH  - Microbial Sensitivity Tests
MH  - Models, Molecular
MH  - Molecular Sequence Data
MH  - Nitric Oxide/biosynthesis
MH  - Phylogeny
MH  - Protein Conformation
MH  - Solutions
MH  - Cathelicidins
EDAT- 2013/04/19 06:00
MHDA- 2013/07/10 06:00
CRDT- 2013/04/19 06:00
PHST- 2013/04/19 06:00 [entrez]
PHST- 2013/04/19 06:00 [pubmed]
PHST- 2013/07/10 06:00 [medline]
AID - 10.1021/jm4004158 [doi]
PST - ppublish
SO  - J Med Chem. 2013 May 9;56(9):3546-56. doi: 10.1021/jm4004158. Epub 2013 Apr 29.